DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3708 and VPS75

DIOPT Version :9

Sequence 1:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_014153.1 Gene:VPS75 / 855475 SGDID:S000005190 Length:264 Species:Saccharomyces cerevisiae


Alignment Length:219 Identity:41/219 - (18%)
Similarity:74/219 - (33%) Gaps:57/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 VPRFWLTVFQNVPLLSELVQDHDEPLLESLMDVRL--------AYDQDSYMVIFQFR--PNSFLH 219
            :..||..|.......:..::..|...::::..:::        .||...:.:.|.|.  ...|..
Yeast    54 IAEFWKIVLSQHVSFANYIRASDFKYIDTIDKIKVEWLALESEMYDTRDFSITFHFHGIEGDFKE 118

  Fly   220 DSSLLLTKRYFLQHSADPEYPFLFEGPEIVRCEGCHIHW---RDGSNLTL----QTVESRRRNRA 277
            ..   :||.:.::...|.:.    :|  |:..|...|.|   .|..|..|    ::.|.:::.|.
Yeast   119 QQ---VTKVFQIKKGKDDQE----DG--ILTSEPVPIEWPQSYDSINPDLIKDKRSPEGKKKYRQ 174

  Fly   278 HRVTKVMPRESFFRFFAPPQALDLSLADEKTKLILGNDFEVG----FLLRTQIVPKAVLFYT--- 335
            ...|..    .:||:               |.|..|.:|..|    .|...:|.|..|.:|.   
Yeast   175 GMKTIF----GWFRW---------------TGLKPGKEFPHGDSLASLFSEEIYPFCVKYYAEAQ 220

  Fly   336 GDLVDSLSAASPDSRSLSSEAEQE 359
            .||.|     ......||::.:.|
Yeast   221 RDLED-----EEGESGLSADGDSE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3708NP_569871.2 NAP 71..336 CDD:279323 35/194 (18%)
VPS75NP_014153.1 NAP 20..183 CDD:415499 23/141 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.