DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3708 and NAP1;3

DIOPT Version :9

Sequence 1:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_568844.1 Gene:NAP1;3 / 835797 AraportID:AT5G56950 Length:374 Species:Arabidopsis thaliana


Alignment Length:323 Identity:82/323 - (25%)
Similarity:148/323 - (45%) Gaps:53/323 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LRHMIGQLAEPVQN-------RIRALRHNQLQQVRISEQFFREVYELERRFYGQSCALFDARRDI 115
            |:::.||.::.::|       |:..||..|.:...|..:|..|...||.::......|::.|.:|
plant    33 LQNLAGQHSDVLENLTPKIRRRVEVLREIQGKHDEIETKFREERAALEAKYQKLYQPLYNKRYEI 97

  Fly   116 LEGSVEPPIQTEKTWPEDPQDALYLDFGNNEELRQLRQKLAPVSPTTLGVPRFWLTVFQNVPLLS 180
            :.|:.|     .:..|||.:    :|.|:.:...:            .|||.||||..:|..::|
plant    98 VNGATE-----VEGAPEDAK----MDQGDEKTAEE------------KGVPSFWLTALKNNDVIS 141

  Fly   181 ELVQDHDEPLLESLMDVRLAYDQD--SYMVIFQFRPNSFLHDSSLLLTKRYFLQHSADPEYPFLF 243
            |.:.:.||..|..|.|::....::  .:.:.|.|..|.:..::  ||||.|   |..|.:.|.| 
plant   142 EEITERDEGALIYLKDIKWCKIEEPKGFKLEFFFDQNPYFKNT--LLTKAY---HMIDEDEPLL- 200

  Fly   244 EGPEIVRCEGCHIHWRDGSNLTLQTVESRRR---NRAHRVTKVMPRESFFRFFAPPQA------L 299
                 .:..|..|.|..|..||.:.::.:.:   ..|..:||....||||.||.|||.      :
plant   201 -----EKAIGTEIDWYPGKCLTQKILKKKPKKGAKNAKPITKTEDCESFFNFFNPPQVPDDDEDI 260

  Fly   300 DLSLADEKTKLILGNDFEVGFLLRTQIVPKAVLFYTGDLV--DSLSAASPDSRSLSSEAEQEQ 360
            |...|:|...| :..|:::|..:|.:|:|.||.::||:.:  :.....:.|...:..:.::::
plant   261 DEERAEELQNL-MEQDYDIGSTIREKIIPHAVSWFTGEAIEGEEFEIDNDDEDDIDEDEDEDE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3708NP_569871.2 NAP 71..336 CDD:279323 76/282 (27%)
NAP1;3NP_568844.1 NAP 53..297 CDD:395763 76/276 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 165 1.000 Domainoid score I1209
eggNOG 1 0.900 - - E1_KOG1507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I1355
OMA 1 1.010 - - QHG53841
OrthoDB 1 1.010 - - D1216172at2759
OrthoFinder 1 1.000 - - FOG0000988
OrthoInspector 1 1.000 - - mtm1101
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X426
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.