DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3708 and NAP1;4

DIOPT Version :9

Sequence 1:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001319544.1 Gene:NAP1;4 / 820589 AraportID:AT3G13782 Length:317 Species:Arabidopsis thaliana


Alignment Length:346 Identity:84/346 - (24%)
Similarity:141/346 - (40%) Gaps:79/346 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RADGISGSLRSLGTYTQESTEPAL----SPADLPARSRKAFLRHM--IGQLAEPVQNRIRALRHN 79
            ::|..||....|.|.      |||    ...||.|..:...|:..  :.:|:..|..|:..|:..
plant     8 KSDNKSGDSSDLPTI------PALDIGAEECDLLAELKNLTLKRPFDVKKLSPKVTKRVLFLKDI 66

  Fly    80 QLQQVRISEQFFREVYELERRFYGQSCALFDARRDILEGSVEPPIQTEKTWPEDPQDALYLDFGN 144
            |:....:.|:|..|...||..:......||..|.:|:.|.||...:.|                 
plant    67 QVTHDELEEKFLAEKSALEATYDNLYKPLFAKRYEIVNGVVEAEAEKE----------------- 114

  Fly   145 NEELRQLRQKLAPVSPTTLGVPRFWLTVFQNVPLLSELVQDHDEPLLESLMDVRLAYDQD---SY 206
                               |||.|||...:...:|:..:.:.||..|:.|.|:|....:|   ::
plant   115 -------------------GVPNFWLIAMKTNEMLANEITERDEAALKYLKDIRSCRVEDTSRNF 160

  Fly   207 MVIFQFRPNSFLHDSSLLLTKRYFLQHSADPEYPFLFEGPEIVRCEGCHIHWRDGSNLTLQTVES 271
            .:.|.|..|.:..:|  :|:|.|   |..|.      :||.:.:..|..|.|..|..||.:.|..
plant   161 KLEFLFDSNLYFKNS--VLSKTY---HVNDE------DGPVLEKVIGTDIEWFPGKCLTHKVVVK 214

  Fly   272 RRRNRAHR------VTKVMPRESFFRFFAPPQALDLSLAD----------EKTKLILGNDFEVGF 320
            ::..:..:      :||....||||.||.||:..::...|          |:.:.::..|:::..
plant   215 KKTKKGPKKVNNIPMTKTENCESFFNFFKPPEIPEIDEVDDYDDFDTIMTEELQNLMDQDYDIAV 279

  Fly   321 LLRTQIVPKAVLFYTGD-LVD 340
            .:|.:::|.||.::||: |||
plant   280 TIRDKLIPHAVSWFTGEALVD 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3708NP_569871.2 NAP 71..336 CDD:279323 65/283 (23%)
NAP1;4NP_001319544.1 NAP 58..296 CDD:395763 66/284 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 165 1.000 Domainoid score I1209
eggNOG 1 0.900 - - E1_KOG1507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I1355
OMA 1 1.010 - - QHG53841
OrthoDB 1 1.010 - - D1216172at2759
OrthoFinder 1 1.000 - - FOG0000988
OrthoInspector 1 1.000 - - mtm1101
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X426
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.