DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3708 and TSPYL1

DIOPT Version :9

Sequence 1:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_003300.1 Gene:TSPYL1 / 7259 HGNCID:12382 Length:437 Species:Homo sapiens


Alignment Length:251 Identity:52/251 - (20%)
Similarity:89/251 - (35%) Gaps:74/251 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 ARRDILEGSVEPPIQTEKTWP------EDPQDALYLDFGN-----NEELRQLRQKLAPVSPTTL- 163
            |..|.||   |...:.|..||      .||.:|:.|:...     :...:||..|...:....| 
Human   205 AEEDRLE---EEAREEEGPWPLHEALRMDPLEAIQLELDTVNAQADRAFQQLEHKFGRMRRHYLE 266

  Fly   164 -------GVPRFWLTVFQNVPLLSELVQDHDEPLLESLMDV---RLAYDQDSYMVIFQFRPNSFL 218
                   .:|.||:|.|:|.|.||.:::..|..:|..:.::   .|.:.:......|.||.|.:.
Human   267 RRNYIIQNIPGFWMTAFRNHPQLSAMIRGQDAEMLRYITNLEVKELRHPRTGCKFKFFFRRNPYF 331

  Fly   219 HDSSLLLTKRYFLQHSADPEYPFLFEGPEIVRCEGCHIHWRDGSNLTLQTVESRRRNRAHRVTKV 283
            .:.  |:.|.|.::.|.           .:|.. ...|.||                |.|.....
Human   332 RNK--LIVKEYEVRSSG-----------RVVSL-STPIIWR----------------RGHEPQSF 366

  Fly   284 MPRE-----SFFRFFAPPQALDLSLADEKTKLILGNDFEVGFLLRTQIVPKAVLFY 334
            :.|.     |||.:|:     |.||.:..         ::..:::..:.|..:.:|
Human   367 IRRNQDLICSFFTWFS-----DHSLPESD---------KIAEIIKEDLWPNPLQYY 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3708NP_569871.2 NAP 71..336 CDD:279323 52/251 (21%)
TSPYL1NP_003300.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81
NAP 228..409 CDD:279323 44/225 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152038
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.