DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3708 and Tspyl4

DIOPT Version :10

Sequence 1:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_084479.1 Gene:Tspyl4 / 72480 MGIID:106393 Length:406 Species:Mus musculus


Alignment Length:147 Identity:27/147 - (18%)
Similarity:57/147 - (38%) Gaps:27/147 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VKFEHVEYSSNHLVFEKTSPISVCHYEDVMMTLESEMEGLDGYIASLSPEEQIWVKEDALQNEQL 78
            :.|..::::..||..|...|:      .|.|:.:.|.|..:   |.|||               |
Mouse   454 INFPPIDFTCMHLQREGNDPM------PVFMSWQEETESGE---AQLSP---------------L 494

  Fly    79 VKEAVPWMRKEEAQATTKYRQMLIAQKKKAINKLHGHGAVVR-FNPARNAKAPVNYNEGDTEDDI 142
            ....:|...:|:|......|.:.....::.:.:.|...:..: .:..|..:|.::..:....|::
Mouse   495 AGRMMPLPLEEDAHPLLARRFLDFGHSQRFLQQDHDASSSTKTLSCGRPRRASLSSKDSVKGDNV 559

  Fly   143 --QFLKEIRKKSKKPKK 157
              |..|:::...||.|:
Mouse   560 SQQLTKKLQNLKKKIKQ 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3708NP_569871.2 NAP 71..337 CDD:460010 14/90 (16%)
Tspyl4NP_084479.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..121
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..189
PTZ00007 218..378 CDD:471807
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..406
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.