DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3708 and TSPYL2

DIOPT Version :10

Sequence 1:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_016885215.1 Gene:TSPYL2 / 64061 HGNCID:24358 Length:738 Species:Homo sapiens


Alignment Length:336 Identity:60/336 - (17%)
Similarity:101/336 - (30%) Gaps:166/336 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RSRKAFLRHMIGQLAEPVQNRIRALRHNQLQ----QVRISEQFFREVYELERRFYGQSCALFDAR 112
            |.::...|....:.||.:::.::||...||.    .::..:.|.|    |:|:|. |....|..|
Human   195 RKQRKVKRESRERNAERMESILQALEDIQLDLEAVNIKAGKAFLR----LKRKFI-QMRRPFLER 254

  Fly   113 RDILEGSVEPPIQTEKTWPEDPQDALYLDFGNNEELRQLRQKLAPVSPTTLGVPRFWLTVFQNVP 177
            ||::       ||                                      .:|.||:..|.|.|
Human   255 RDLI-------IQ--------------------------------------HIPGFWVKAFLNHP 274

  Fly   178 LLSELVQDHDE-------------------------------------------------PLLES 193
            .:|.|:...||                                                 |.||.
Human   275 RISILINRRDEDIFRYLTNLQVRPERHFLVGSGTNLVLGGDGRWVGRAVVCWGGDRFHHHPHLEQ 339

  Fly   194 LMDVR---LAYDQDSYMVIFQFRPNSFLHDSSLLLTKRY-------FLQHSADPEYPFLFEGPEI 248
            :.|:|   :.|....|   ||..|    :.:::::.|.:       .:.||..            
Human   340 VQDLRHISMGYKMKLY---FQTNP----YFTNMVIVKEFQRNRSGRLVSHSTP------------ 385

  Fly   249 VRCEGCHIHWRDGSNLTLQTVESRR---RNRAHRVTKVMPRESFFRFFAP---PQALDLSLADEK 307
                   |.|..|     |..::||   ::.:|         |||.:|:.   |:|       ::
Human   386 -------IRWHRG-----QEPQARRHGNQDASH---------SFFSWFSNHSLPEA-------DR 422

  Fly   308 TKLILGNDFEV 318
            ...|:.||..|
Human   423 IAEIIKNDLWV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3708NP_569871.2 NAP 71..337 CDD:460010 56/317 (18%)
TSPYL2XP_016885215.1 PTZ00007 227..440 CDD:471807 52/304 (17%)
MSCRAMM_ClfA <497..666 CDD:468110
DNA_pol_phi <597..648 CDD:461488
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.