DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3708 and nap1l4b

DIOPT Version :9

Sequence 1:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001007454.1 Gene:nap1l4b / 492812 ZFINID:ZDB-GENE-041114-168 Length:367 Species:Danio rerio


Alignment Length:318 Identity:109/318 - (34%)
Similarity:183/318 - (57%) Gaps:23/318 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 MIGQLAEPVQNRIRALRHNQLQQVRISEQFFREVYELERRFYGQSCALFDARRDILEGSVEPPIQ 125
            ::..|.:.|:.|:.|||:.|:....|..:|::||:||||::......|||.||.::.|.|| |..
Zfish    38 IMDSLPKSVKRRVNALRNLQVDSTHIEAKFYKEVHELERKYSALYQPLFDKRRKVVSGEVE-PTD 101

  Fly   126 TEKTWPEDPQD--ALYLDFGNNEELRQLRQKLAPVSPTTLGVPRFWLTVFQNVPLLSELVQDHDE 188
            .|..|..|.:|  ||..|......:.:..:......|.  |:|.||||:|::|.:||:::|:|||
Zfish   102 EECEWQSDHEDEAALAEDLKKKAAIEEKTEDANEEKPK--GIPEFWLTIFRSVDMLSDMLQEHDE 164

  Fly   189 PLLESLMDVRLAY---DQD-SYMVIFQFRPNSFLHDSSLLLTKRYFLQHSADPEYPFLFEGPEIV 249
            |:|:.|.|:::.:   ||. |:.:.|.|.||.:.  ::.:|||.|.::...|.:.||.||||||:
Zfish   165 PILKHLHDIKVIFSGPDQPMSFTLEFHFEPNEYF--TNTVLTKVYKMKSEPDADDPFSFEGPEII 227

  Fly   250 RCEGCHIHWRDGSNLTLQTVESRRRNR----AHRVTKVMPRESFFRFFAPPQALDLSLADEKTKL 310
            .||||.|.|:.|.::|::|::.:::::    |..:||.:|.:|||.||.|.:.......||.::.
Zfish   228 DCEGCEIDWQKGKDVTVKTIKKKQKHKGRGTARVITKQVPNDSFFNFFNPIKVSPDKELDEDSEY 292

  Fly   311 ILGNDFEVGFLLRTQIVPKAVLFYTGDLV--------DSLSAASPDSRSLSSEAEQEQ 360
            .|..|||:|...|.:|||:|||::||:.:        :.|.....:.:....|.|:|:
Zfish   293 TLATDFEIGHFFRERIVPRAVLYFTGEALEDDESFEEEELDEGEEEDQDDEEEEEEEE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3708NP_569871.2 NAP 71..336 CDD:279323 101/274 (37%)
nap1l4bNP_001007454.1 V_Alix_like <19..134 CDD:187408 31/96 (32%)
NAP 48..318 CDD:279323 101/274 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53841
OrthoDB 1 1.010 - - D1216172at2759
OrthoFinder 1 1.000 - - FOG0000988
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X426
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.