DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3708 and NAP1L4

DIOPT Version :9

Sequence 1:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001356309.1 Gene:NAP1L4 / 4676 HGNCID:7640 Length:386 Species:Homo sapiens


Alignment Length:378 Identity:124/378 - (32%)
Similarity:199/378 - (52%) Gaps:53/378 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ADSAEGVTQEDSHTESRADGISGSLRSLGTYTQESTEPALSPADLPARSRKAFLRHMIGQLAEPV 69
            :||.| ..:..|:||...|.:..:.|.|....:.......:|:.            .|..|.:.|
Human    12 SDSVE-AAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSS------------YIETLPKAV 63

  Fly    70 QNRIRALRHNQLQQVRISEQFFREVYELERRFYGQSCALFDARRDILEGSVEPPIQTEKTWPEDP 134
            :.||.||:..|::...|..:|:.||::|||::......|||.||:.:.|.|| |...|..|..: 
Human    64 KRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVE-PTDAESEWHSE- 126

  Fly   135 QDALYLDFGNNEELRQL----------RQKLAPVS--PTTLGVPRFWLTVFQNVPLLSELVQDHD 187
                      |||..:|          .:|.|..:  |...|:|.||.|:|:||.:||||||::|
Human   127 ----------NEEEEKLAGDMKSKVVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYD 181

  Fly   188 EPLLESLMDVRLAYDQD----SYMVIFQFRPNSFLHDSSLLLTKRYFLQHSADPEYPFLFEGPEI 248
            ||:|:.|.|:::.:...    |:::.|.|.||.:..:|  :|||.|.::...|...||.||||||
Human   182 EPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFTNS--VLTKTYKMKSEPDKADPFSFEGPEI 244

  Fly   249 VRCEGCHIHWRDGSNLTLQTVESRRRNR----AHRVTKVMPRESFFRFFAPPQAL-DLSLADEKT 308
            |.|:||.|.|:.|.|:|::|::.:::::    ...:||.:|.||||.||.|.:|. |....||.:
Human   245 VDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASGDGESLDEDS 309

  Fly   309 KLILGNDFEVGFLLRTQIVPKAVLFYTGDLVDSLSAASPDSRSLSSEAEQEQV 361
            :..|.:|||:|...|.:|||:|||::||:.::     ..|:.....|.|:|::
Human   310 EFTLASDFEIGHFFRERIVPRAVLYFTGEAIE-----DDDNFEEGEEGEEEEL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3708NP_569871.2 NAP 71..336 CDD:279323 105/285 (37%)
NAP1L4NP_001356309.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 7/19 (37%)
NAP 67..337 CDD:334326 104/283 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..137 7/31 (23%)
Nuclear localization signal. /evidence=ECO:0000255 265..271 0/5 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53841
OrthoDB 1 1.010 - - D1216172at2759
OrthoFinder 1 1.000 - - FOG0000988
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X426
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.