DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3708 and mil

DIOPT Version :9

Sequence 1:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_651592.2 Gene:mil / 43343 FlyBaseID:FBgn0267366 Length:283 Species:Drosophila melanogaster


Alignment Length:335 Identity:92/335 - (27%)
Similarity:146/335 - (43%) Gaps:90/335 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TEPALSPADLPARSRKAFLRHMIGQLAEPVQNRIRALRHNQLQQVRISEQFFREVYELERRFYGQ 104
            |.|....:||              ...|..:..:..|:...|:.:.:.....|::|.:|:::..:
  Fly    15 TAPPKMESDL--------------NFTEKEKKTLTELKQLYLETINLDVALQRDIYNIEKKYEDK 65

  Fly   105 SCALFDARRDILE-------GSVEPPIQTEKTWPEDPQDALYLDFGNNEELRQLRQKLAPVSPTT 162
            ...:||.|:.||:       |.||                                       |.
  Fly    66 HNIIFDKRKKILDEFRKQNHGDVE---------------------------------------TN 91

  Fly   163 LGVPRFWLTVFQNVPLLSELVQDHDEPLLESLMDVR-LAYDQD--SYMVIFQFRPNSFLHDSSLL 224
            ..||.|||.|.:  ...:|.:...||.:||.|.|:| ..|::.  .:.:.|.|.||.:.  ::.:
  Fly    92 QSVPNFWLRVLK--ASYTEFISKRDEKILECLSDIRSRLYNEPVVKFDIEFHFDPNDYF--TNTV 152

  Fly   225 LTKRYFLQHSADPEYPFLFEGPEIVRCEGCHIHWRDGSNLTLQTVESRRRNRAHRVTKVMPRE-S 288
            |||.|||....||:.|..::|.||.:||||.|.|:       ||.:.         ||...:| |
  Fly   153 LTKTYFLNCLPDPDDPLAYDGAEIYKCEGCVIDWK-------QTKDQ---------TKTENQEPS 201

  Fly   289 FFRFFAPP----QALDLSLADEKTKLILGNDFEVGFLLRTQIVPKAVLFYTGDLVDSLSAASPDS 349
            ||.||:||    ..||.:..|  ...:|.|||||||.|:.:::||||:|:||::.|..|::..::
  Fly   202 FFEFFSPPLLPEDTLDPNYCD--VNAMLQNDFEVGFYLKERVIPKAVIFFTGEIADCQSSSGSET 264

  Fly   350 RSLSSEAEQE 359
            .|..:|.|.:
  Fly   265 ESEDTEDESD 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3708NP_569871.2 NAP 71..336 CDD:279323 80/279 (29%)
milNP_651592.2 NAP 37..251 CDD:279323 80/274 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447474
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1507
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1216172at2759
OrthoFinder 1 1.000 - - FOG0000988
OrthoInspector 1 1.000 - - mtm1101
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.