DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3708 and Set

DIOPT Version :10

Sequence 1:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster


Alignment Length:246 Identity:54/246 - (21%)
Similarity:97/246 - (39%) Gaps:63/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 NEELRQLRQKLAPV--------SPTTLGVPRFWLTVFQNVPLLSELVQDHDEPLLESLMDVRLAY 201
            :||:.::.||...:        |.....:|.||:|.|.|.|.:|.::.:.:|..|.:|..:.:..
  Fly    51 SEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEE 115

  Fly   202 DQD---SYMVIFQFRPNSFLHDSSLLLTKRYFLQHSADPE---YPFLFEGPEIVRCEGCHIHWRD 260
            .:|   .|.:.|.|..|.:..:.  :|||.:.|..:|..|   :|.....|         |.|::
  Fly   116 FEDIKSGYRINFHFDENPYFENK--VLTKEFHLNSAAASENGDWPASTSTP---------IKWKE 169

  Fly   261 GSN-----LTLQTVESRRRNRAHRVTKVMPRESFFRFFAPPQALDLSLADEKTKLILGNDFEVGF 320
            |.|     ||......::||..::        :||.:|:           :.|..:  || |:..
  Fly   170 GKNLLKLLLTKPYGNKKKRNSEYK--------TFFDWFS-----------DNTDPV--ND-EIAE 212

  Fly   321 LLRTQIVPKAVLFY-----------TGDLVDSLSAASPDSRSLSSEAEQEQ 360
            |::..:.|..:.:|           ..|..|:...|..|......|.|:|:
  Fly   213 LIKDDLWPNPLQYYLVPDIEVEPEDEEDNEDNDEEAFDDEDGEDGEGEEEE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3708NP_569871.2 NAP 71..337 CDD:460010 47/221 (21%)
SetNP_650438.2 NAP 31..227 CDD:460010 46/208 (22%)

Return to query results.
Submit another query.