DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3708 and tspy

DIOPT Version :9

Sequence 1:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_956349.1 Gene:tspy / 337214 ZFINID:ZDB-GENE-030131-9158 Length:519 Species:Danio rerio


Alignment Length:405 Identity:81/405 - (20%)
Similarity:127/405 - (31%) Gaps:156/405 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GVTQEDSHTESRADGISGSLRSLGTYTQESTEPALSPAD---------LPARSRKAF-------- 57
            |.:|.|..||:.|...|.||    ...::..:|:....|         ||..|..|.        
Zfish   147 GCSQSDRRTEAAAADSSSSL----LLCEDQEDPSFVDDDEEEEEDEDSLPGSSSTASSSVASDNE 207

  Fly    58 -----------------LRHMIGQLAEPVQNRIRAL-----RHNQLQQVRISEQFFREVYELERR 100
                             :|..:..||: ||.|:.||     |.:|..::::|             
Zfish   208 DNEDGECAIVSVKMAPEVRQSVALLAQ-VQMRLDALEKKGARLHQRLEMKLS------------- 258

  Fly   101 FYGQSCALFDARRDILEGSVEPPIQTEKTWPEDPQDALYLDFGNNEELRQLRQKLAPVSPTTLGV 165
                                                            ||.|..|...|..|..|
Zfish   259 ------------------------------------------------RQRRPHLDQRSAITQAV 275

  Fly   166 PRFWLTVFQNVPLLSELVQDHDEPLLESLMDVRLAYDQDS---YMVIFQFRPNSFLHDSSLLLTK 227
            |.||:|...|.|.||..:.:.||..|..:.::.:...:::   |.:.|.||.|.|..:.  ::.|
Zfish   276 PGFWVTALLNHPHLSAHIDETDEDALSYMTNLEIESFKNNKLGYRICFHFRRNPFFQNK--MIVK 338

  Fly   228 RYFLQHSADPEYPFLFEGPEIVRCEGCHIHWRDGSNLTLQTVESRRRNRAHRVTKVMPRESFFRF 292
            ...|.....   |..|..|         |.|..|.|| :.:.|.||.::.       ..:|||.:
Zfish   339 ELHLGMGGS---PVSFSNP---------ILWHRGQNL-VGSGEPRRTSQG-------VYQSFFHW 383

  Fly   293 FAPPQALDLSLADEKTKLILGNDFEVGFLLRTQIVPKAVLFYTGDL----VDSLSAASPDSRS-- 351
            |          :|....   |.| ::..:||..:....:.:|...|    .:..||..|...|  
Zfish   384 F----------SDHSNP---GRD-DIAQILREDLYRNPLRYYLTPLWEPRENGSSAPKPQGSSNR 434

  Fly   352 ------LSSEAEQEQ 360
                  ..|:.::||
Zfish   435 DECVIISDSDEDEEQ 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3708NP_569871.2 NAP 71..336 CDD:279323 53/272 (19%)
tspyNP_956349.1 NAP 227..403 CDD:298680 56/273 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.