DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3708 and Tspy26

DIOPT Version :10

Sequence 1:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001099997.1 Gene:Tspy26 / 296280 RGDID:1310192 Length:334 Species:Rattus norvegicus


Alignment Length:218 Identity:50/218 - (22%)
Similarity:77/218 - (35%) Gaps:55/218 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DPQDALYLDF--------GNNEEL-----RQLRQKLAPVSPTTLGVPRFWLTVFQNVPLLSELVQ 184
            ||.:|:..:|        |.:.:|     |..|..||..|.....:|.||:|.|.|.|.||.::.
  Rat   126 DPLEAIQWEFEVMSAQSDGAHLQLVRRFERMRRLHLARRSFIIQNIPGFWVTAFLNHPQLSAMIS 190

  Fly   185 DHDEPLLESLMDV---RLAYDQDSYMVIFQFRPNSFLHDSSLLLTKRYFLQHSADPEYPFLFEGP 246
            ..||.:|..||::   .|.:.:......|.|..|.:..:.  ::.|.|..:.|..          
  Rat   191 PRDEDMLGYLMNLEVRELRHTRTGCKFKFLFGSNPYFRNE--VIVKEYECRSSGR---------- 243

  Fly   247 EIVRCEGCHIHWRDGSNLTLQTVESRRRNRAHRVTKVMPRESFFRFFAPPQALDLSLADEKTKLI 311
              |......|.|..|.....         ..||....|  .|||.:|:....|:   ||      
  Rat   244 --VVAIATRIRWHRGQEPPA---------LVHRNRDTM--RSFFSWFSQHSLLE---AD------ 286

  Fly   312 LGNDFEVGFLLRTQIVPKAVLFY 334
                 .|..:|:..:.|..:.:|
  Rat   287 -----RVAQILKDDLWPNPLQYY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3708NP_569871.2 NAP 71..337 CDD:460010 50/218 (23%)
Tspy26NP_001099997.1 PTZ00007 138..305 CDD:471807 46/206 (22%)

Return to query results.
Submit another query.