DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3708 and NAP1L5

DIOPT Version :9

Sequence 1:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_715638.1 Gene:NAP1L5 / 266812 HGNCID:19968 Length:182 Species:Homo sapiens


Alignment Length:166 Identity:36/166 - (21%)
Similarity:66/166 - (39%) Gaps:33/166 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MADSAEGVTQEDSHTESRADGISGSLRSLG----------------TYTQESTEPALSPADLPAR 52
            ||||......|.|...:.|:..:..:.:.|                ...|.:.||. :||:...:
Human     1 MADSENQGPAEPSQAAAAAEAAAEEVMAEGGAQGGDCDSAAGDPDSAAGQMAEEPQ-TPAENAPK 64

  Fly    53 SRKAFLRHMIGQLAEPVQNRIRALRHNQLQQVRISEQFFREVYELERRF---YGQSCALFDARRD 114
            .:..|    |..|...|:.|:.||:..|.:..:|..:|.:|...||:::   |....|.......
Human    65 PKNDF----IESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKIQELTG 125

  Fly   115 ILEG---SVEPPIQTEKTWPEDPQDALYLDFGNNEE 147
            .:||   ::|...:.|:.:.:|.::      |.:||
Human   126 EMEGCAWTLEGEEEEEEEYEDDEEE------GEDEE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3708NP_569871.2 NAP 71..336 CDD:279323 19/83 (23%)
NAP1L5NP_715638.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 14/74 (19%)
NAP 81..>127 CDD:385322 10/45 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..182 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152005
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.