DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3708 and Tspyl1

DIOPT Version :9

Sequence 1:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_033459.1 Gene:Tspyl1 / 22110 MGIID:1298395 Length:379 Species:Mus musculus


Alignment Length:269 Identity:54/269 - (20%)
Similarity:94/269 - (34%) Gaps:76/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EVYELERRFYGQSCALFDARRDILEGSVEPPIQTEKTW------PEDPQDALYLDFGN-----NE 146
            ||.|:|::..|:...:.:|     .|.|....:....|      ..:|.:|:.|:...     :.
Mouse   131 EVMEVEQKPAGEEMEMLEA-----SGGVREAPEEAGPWHLGIDLRRNPLEAIQLELDTVNAQADR 190

  Fly   147 ELRQLRQKLAPVSPTTL--------GVPRFWLTVFQNVPLLSELVQDHDEPLLE---SLMDVRLA 200
            ..:.|.||...:....|        .:|.||:|.|:|.|.||.:::..|..:|.   ||....|.
Mouse   191 AFQHLEQKFGRMRRHYLERRNYIIQNIPGFWMTAFRNHPQLSAMIRGRDAEMLRYVTSLEVKELR 255

  Fly   201 YDQDSYMVIFQFRPNSFLHDSSLLLTKRYFLQHSADPEYPFLFEGPEIVRCEGCHIHWRDGSNLT 265
            :.:......|.||.|.:..:.  |:.|.|.::.|.           .:|.. ...|.||      
Mouse   256 HPKTGCKFKFFFRRNPYFRNK--LIVKEYEVRSSG-----------RVVSL-STPIIWR------ 300

  Fly   266 LQTVESRRRNRAHRVTKVMPRE-----SFFRFFAPPQALDLSLADEKTKLILGNDFEVGFLLRTQ 325
                      |.|.....:.|.     |||.:|:     |.||.:..         .:..:::..
Mouse   301 ----------RGHEPQSFIRRNQDLICSFFTWFS-----DHSLPESD---------RIAEIIKED 341

  Fly   326 IVPKAVLFY 334
            :.|..:.:|
Mouse   342 LWPNPLQYY 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3708NP_569871.2 NAP 71..336 CDD:279323 54/269 (20%)
Tspyl1NP_033459.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..134 2/2 (100%)
NAP 174..351 CDD:298680 44/221 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842132
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.