DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED22 and MED22B

DIOPT Version :9

Sequence 1:NP_569870.1 Gene:MED22 / 31038 FlyBaseID:FBgn0040339 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001322426.1 Gene:MED22B / 837310 AraportID:AT1G07950 Length:184 Species:Arabidopsis thaliana


Alignment Length:129 Identity:40/129 - (31%)
Similarity:79/129 - (61%) Gaps:9/129 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QSKEALLKSYNARLKDDVRSMLENFEEILKLARRESHSQISKTTQCEQDALEMQVRAANMVRAGE 76
            |.::|||:    |::.|:.|:::||.:|:.:: |.|...:..:    |:...|::||:.||:|.:
plant    57 QKQKALLQ----RVETDITSVVDNFTQIVNVS-RVSDPPVKNS----QETYMMEMRASRMVQAAD 112

  Fly    77 SLMKLVADLKQYLILNDFHSVNEAITNNSQLFRNTQSECDKKLMKLRDEMAMDLYDLEEEYYTS 140
            ||:|||::|||..|.:.|.|:|:.:....:.|.....:.::.|.::.|:.:.:|.:||..||:|
plant   113 SLLKLVSELKQTAIFSGFASLNDHVEQRIEEFDQEAEKTNRLLARIADDASANLKELESHYYSS 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED22NP_569870.1 Med22 24..128 CDD:399290 30/103 (29%)
MED22BNP_001322426.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I4045
eggNOG 1 0.900 - - E1_KOG3304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I2454
OMA 1 1.010 - - QHG55431
OrthoDB 1 1.010 - - D1573728at2759
OrthoFinder 1 1.000 - - FOG0004687
OrthoInspector 1 1.000 - - mtm1170
orthoMCL 1 0.900 - - OOG6_104932
Panther 1 1.100 - - LDO PTHR12434
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.