DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED22 and MED22

DIOPT Version :9

Sequence 1:NP_569870.1 Gene:MED22 / 31038 FlyBaseID:FBgn0040339 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_598395.1 Gene:MED22 / 6837 HGNCID:11477 Length:200 Species:Homo sapiens


Alignment Length:131 Identity:87/131 - (66%)
Similarity:109/131 - (83%) Gaps:0/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LPQSKEALLKSYNARLKDDVRSMLENFEEILKLARRESHSQISKTTQCEQDALEMQVRAANMVRA 74
            ||||||.||:|||.|||||::|:::||.||:|.|:.|..:|:|:.||.|||..||.|||||:|||
Human     7 LPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRA 71

  Fly    75 GESLMKLVADLKQYLILNDFHSVNEAITNNSQLFRNTQSECDKKLMKLRDEMAMDLYDLEEEYYT 139
            ||||||||:||||:||||||.||||||...:|..|..|.|||:||:.||||:::|||:||||||:
Human    72 GESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYS 136

  Fly   140 S 140
            |
Human   137 S 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED22NP_569870.1 Med22 24..128 CDD:399290 66/103 (64%)
MED22NP_598395.1 Med22 20..124 CDD:283768 66/103 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..200
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145388
Domainoid 1 1.000 134 1.000 Domainoid score I5043
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4913
Inparanoid 1 1.050 178 1.000 Inparanoid score I4039
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55431
OrthoDB 1 1.010 - - D1573728at2759
OrthoFinder 1 1.000 - - FOG0004687
OrthoInspector 1 1.000 - - oto88320
orthoMCL 1 0.900 - - OOG6_104932
Panther 1 1.100 - - LDO PTHR12434
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4644
SonicParanoid 1 1.000 - - X5835
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.