DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED22 and med22

DIOPT Version :9

Sequence 1:NP_569870.1 Gene:MED22 / 31038 FlyBaseID:FBgn0040339 Length:143 Species:Drosophila melanogaster
Sequence 2:XP_005171888.1 Gene:med22 / 415234 ZFINID:ZDB-GENE-040625-156 Length:198 Species:Danio rerio


Alignment Length:136 Identity:91/136 - (66%)
Similarity:112/136 - (82%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRTTILPQSKEALLKSYNARLKDDVRSMLENFEEILKLARRESHSQISKTTQCEQDALEMQVRAA 69
            |...:||||||.||::||.|||||:||:|:||.||:|.|:.|..:|:|:.||.|||..||.||||
Zfish     2 STPRVLPQSKETLLQNYNKRLKDDIRSILDNFTEIIKTAKVEDETQVSRATQAEQDHFEMHVRAA 66

  Fly    70 NMVRAGESLMKLVADLKQYLILNDFHSVNEAITNNSQLFRNTQSECDKKLMKLRDEMAMDLYDLE 134
            |:|||||||||||:||||:||||||.||||||:..:|..|..|.||||||:.||||:|:|||:||
Zfish    67 NIVRAGESLMKLVSDLKQFLILNDFPSVNEAISLRNQQLRTLQEECDKKLISLRDEIAIDLYELE 131

  Fly   135 EEYYTS 140
            ||||:|
Zfish   132 EEYYSS 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED22NP_569870.1 Med22 24..128 CDD:399290 69/103 (67%)
med22XP_005171888.1 Med22 20..124 CDD:283768 69/103 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578649
Domainoid 1 1.000 140 1.000 Domainoid score I4716
eggNOG 1 0.900 - - E1_KOG3304
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4913
Inparanoid 1 1.050 184 1.000 Inparanoid score I3941
OMA 1 1.010 - - QHG55431
OrthoDB 1 1.010 - - D1573728at2759
OrthoFinder 1 1.000 - - FOG0004687
OrthoInspector 1 1.000 - - oto39627
orthoMCL 1 0.900 - - OOG6_104932
Panther 1 1.100 - - LDO PTHR12434
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4644
SonicParanoid 1 1.000 - - X5835
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.