DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED22 and CG32971

DIOPT Version :9

Sequence 1:NP_569870.1 Gene:MED22 / 31038 FlyBaseID:FBgn0040339 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001137823.1 Gene:CG32971 / 318271 FlyBaseID:FBgn0052971 Length:145 Species:Drosophila melanogaster


Alignment Length:124 Identity:58/124 - (46%)
Similarity:84/124 - (67%) Gaps:0/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EALLKSYNARLKDDVRSMLENFEEILKLARRESHSQISKTTQCEQDALEMQVRAANMVRAGESLM 79
            ||||||:..:|||:|.|||.||||:|||....:..||:..|:.|.:|.||||||.|.|||||:|:
  Fly     7 EALLKSFKTQLKDNVLSMLLNFEELLKLVSPRTPGQITNDTEQELNAFEMQVRAGNFVRAGEALI 71

  Fly    80 KLVADLKQYLILNDFHSVNEAITNNSQLFRNTQSECDKKLMKLRDEMAMDLYDLEEEYY 138
            |||.|:|:|.|:.|:.::.|.:...|:......:|.|:.|:|:..::..:|.:||.|||
  Fly    72 KLVHDVKEYQIIYDYSNIEEEMDRQSEAMHAKVTEYDQTLIKMVKDLEEELSELEYEYY 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED22NP_569870.1 Med22 24..128 CDD:399290 46/103 (45%)
CG32971NP_001137823.1 Med22 15..117 CDD:283768 46/101 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446130
Domainoid 1 1.000 56 1.000 Domainoid score I4045
eggNOG 1 0.900 - - E1_KOG3304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I2454
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55431
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004687
OrthoInspector 1 1.000 - - mtm1170
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12434
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.