DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED22 and mdt-22

DIOPT Version :9

Sequence 1:NP_569870.1 Gene:MED22 / 31038 FlyBaseID:FBgn0040339 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_496216.1 Gene:mdt-22 / 174595 WormBaseID:WBGene00007022 Length:157 Species:Caenorhabditis elegans


Alignment Length:146 Identity:49/146 - (33%)
Similarity:82/146 - (56%) Gaps:22/146 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGSRTTILPQSKEALLKSYNARLKDDVRSMLENFEEILKLAR-----RESHSQISKTTQCEQDAL 62
            |.|||.   .:|:.::..:..||:|:::|:.:||..|::.|:     ....:|..|.|:......
 Worm    12 SSSRTM---ATKKLIIDEFKRRLRDNIKSLNDNFFHIIQAAKVNPDDNAYKNQTGKMTEFYTTKN 73

  Fly    63 EMQVRAANMVRAGESLMKLVADLKQYLILNDFHSVNEAITNNSQLFRNTQSECDKKLMK------ 121
            ||.|||..||||.:.|:||.||||::|||:|||    .:|:|   .:..:::|::.|.:      
 Worm    74 EMAVRAQLMVRASDELLKLTADLKEFLILHDFH----FLTHN---IKQAEAQCEETLRQQSHQHN 131

  Fly   122 -LRDEMAMDLYDLEEE 136
             |..|::..|:|||.|
 Worm   132 CLDSEVSNILFDLERE 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED22NP_569870.1 Med22 24..128 CDD:399290 39/115 (34%)
mdt-22NP_496216.1 Med22 29..139 CDD:283768 39/116 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158552
Domainoid 1 1.000 62 1.000 Domainoid score I6846
eggNOG 1 0.900 - - E1_KOG3304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3891
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55431
OrthoDB 1 1.010 - - D1573728at2759
OrthoFinder 1 1.000 - - FOG0004687
OrthoInspector 1 1.000 - - otm14177
orthoMCL 1 0.900 - - OOG6_104932
Panther 1 1.100 - - LDO PTHR12434
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4644
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.