| Sequence 1: | NP_001259114.1 | Gene: | Lztr1 / 31037 | FlyBaseID: | FBgn0040344 | Length: | 998 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001259431.1 | Gene: | BTBD9 / 32000 | FlyBaseID: | FBgn0030228 | Length: | 722 | Species: | Drosophila melanogaster |
| Alignment Length: | 203 | Identity: | 55/203 - (27%) |
|---|---|---|---|
| Similarity: | 92/203 - (45%) | Gaps: | 38/203 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 563 DFGKFFQDKQFCDIQFIVGAEEIRILAHIAFVAARSKYLRNKILAA-REARQQQMEKVYGVGQVD 626
Fly 627 ALALNAGAGGDRGPMLEVRLANASPEAFEIILNYIYTDRIDLKDTYSKNIIILITDIYQLAGLFT 691
Fly 692 MPRLAHGCIQYLDYKINKLNVLEALYNADKSNIKIIKDHCMQFIIKEENFTDVVMSSEFSDLDKP 756
Fly 757 LLVEIIRK 764 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lztr1 | NP_001259114.1 | PLN02153 | 237..554 | CDD:177814 | |
| KELCH repeat | 252..298 | CDD:276965 | |||
| Kelch_3 | 261..310 | CDD:290151 | |||
| Kelch_5 | 299..>329 | CDD:290565 | |||
| KELCH repeat | 302..355 | CDD:276965 | |||
| Kelch_1 | 358..400 | CDD:279660 | |||
| KELCH repeat | 359..407 | CDD:276965 | |||
| KELCH repeat | 410..455 | CDD:276965 | |||
| Kelch_1 | 410..452 | CDD:279660 | |||
| Kelch_1 | 466..509 | CDD:279660 | |||
| KELCH repeat | 467..509 | CDD:276965 | |||
| BTB | 564..704 | CDD:279045 | 38/140 (27%) | ||
| BTB | 575..707 | CDD:197585 | 38/132 (29%) | ||
| SPOP_C_like | 707..766 | CDD:269810 | 15/58 (26%) | ||
| BTB | 798..898 | CDD:279045 | |||
| BTB | 802..902 | CDD:197585 | |||
| SPOP_C_like | 902..960 | CDD:269810 | |||
| BTBD9 | NP_001259431.1 | BTB | 42..141 | CDD:279045 | 37/133 (28%) |
| BTB | 47..145 | CDD:197585 | 38/132 (29%) | ||
| BACK_BTBD9_like | 145..203 | CDD:269811 | 15/58 (26%) | ||
| F5_F8_type_C | 299..399 | CDD:304887 | |||
| F5_F8_type_C | 451..554 | CDD:279139 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||