Sequence 1: | NP_001259114.1 | Gene: | Lztr1 / 31037 | FlyBaseID: | FBgn0040344 | Length: | 998 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_663580.2 | Gene: | Klhdc4 / 234825 | MGIID: | 2384569 | Length: | 584 | Species: | Mus musculus |
Alignment Length: | 283 | Identity: | 65/283 - (22%) |
---|---|---|---|
Similarity: | 118/283 - (41%) | Gaps: | 46/283 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 261 KDAMFVFGGD--NGKN--MLNDLIRFGVKDKSWGRACATGTPPAPRYHHSAVV---AGSSMFIFG 318
Fly 319 GYTGDIHSNSNLTNKNDLFEYKFQSAMWVEWKFSGRQPVPRSAHGAAVYDNKMWIYAGYDGNAR- 382
Fly 383 ---LNDMWTLNLTGENQWEEVDQLGDRPPTCCNFPVAVA-RDAMYVFSGQSGLQITNSLFE---- 439
Fly 440 ---FHFKTR-------TWRRISNEPVLRGATSAPPSRRYGHTM-VHHDRFLYVFGG--------S 485
Fly 486 ADSTLPNDLHCYDLDSQVWSVIQ 508 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lztr1 | NP_001259114.1 | PLN02153 | 237..554 | CDD:177814 | 65/283 (23%) |
KELCH repeat | 252..298 | CDD:276965 | 12/40 (30%) | ||
Kelch_3 | 261..310 | CDD:290151 | 19/55 (35%) | ||
Kelch_5 | 299..>329 | CDD:290565 | 10/32 (31%) | ||
KELCH repeat | 302..355 | CDD:276965 | 13/55 (24%) | ||
Kelch_1 | 358..400 | CDD:279660 | 11/45 (24%) | ||
KELCH repeat | 359..407 | CDD:276965 | 12/51 (24%) | ||
KELCH repeat | 410..455 | CDD:276965 | 9/59 (15%) | ||
Kelch_1 | 410..452 | CDD:279660 | 9/56 (16%) | ||
Kelch_1 | 466..509 | CDD:279660 | 14/52 (27%) | ||
KELCH repeat | 467..509 | CDD:276965 | 14/51 (27%) | ||
BTB | 564..704 | CDD:279045 | |||
BTB | 575..707 | CDD:197585 | |||
SPOP_C_like | 707..766 | CDD:269810 | |||
BTB | 798..898 | CDD:279045 | |||
BTB | 802..902 | CDD:197585 | |||
SPOP_C_like | 902..960 | CDD:269810 | |||
Klhdc4 | NP_663580.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..33 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 50..69 | ||||
KELCH repeat | 64..115 | CDD:276965 | 11/39 (28%) | ||
Kelch_3 | 75..127 | CDD:290151 | 18/52 (35%) | ||
Kelch 1 | 77..129 | 17/52 (33%) | |||
KELCH repeat | 119..174 | CDD:276965 | 13/56 (23%) | ||
Kelch_3 | 131..185 | CDD:290151 | 12/55 (22%) | ||
Kelch 2 | 133..187 | 11/55 (20%) | |||
Kelch_5 | 174..216 | CDD:290565 | 10/42 (24%) | ||
KELCH repeat | 177..223 | CDD:276965 | 11/46 (24%) | ||
Kelch 3 | 188..238 | 10/50 (20%) | |||
KELCH repeat | 231..293 | CDD:276965 | 9/68 (13%) | ||
Kelch 4 | 243..289 | 7/52 (13%) | |||
Kelch 5 | 308..361 | 11/39 (28%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 348..381 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 405..433 | ||||
Kelch_1 | 431..480 | CDD:279660 | |||
KELCH repeat | 432..480 | CDD:276965 | |||
Kelch 6 | 443..494 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 482..533 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1494 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |