| Sequence 1: | NP_001259114.1 | Gene: | Lztr1 / 31037 | FlyBaseID: | FBgn0040344 | Length: | 998 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_024302088.1 | Gene: | KLHDC3 / 116138 | HGNCID: | 20704 | Length: | 395 | Species: | Homo sapiens |
| Alignment Length: | 232 | Identity: | 64/232 - (27%) |
|---|---|---|---|
| Similarity: | 104/232 - (44%) | Gaps: | 29/232 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 212 GKATSPGSYSCNALNVDFTSYTATHQWTRMLECAEFVGAKRSKHTVVAYKDAMFVFGG--DNGKN 274
Fly 275 MLNDLIRFGVKDKSWGRACATGTPPAPRYHHSAVVAGSSMFIFGGYT---GDIHSNSNL-TNKND 335
Fly 336 LFEYKFQSAMWVEWKFSGRQPVPRSAHGAAVYDNKMWIYAGYDGNARLN----DMWTLNLTGENQ 396
Fly 397 WEEVDQLGDRP----PTCCNFPVAVARDAMYVFSGQS 429 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lztr1 | NP_001259114.1 | PLN02153 | 237..554 | CDD:177814 | 57/207 (28%) |
| KELCH repeat | 252..298 | CDD:276965 | 11/47 (23%) | ||
| Kelch_3 | 261..310 | CDD:290151 | 14/50 (28%) | ||
| Kelch_5 | 299..>329 | CDD:290565 | 14/32 (44%) | ||
| KELCH repeat | 302..355 | CDD:276965 | 17/56 (30%) | ||
| Kelch_1 | 358..400 | CDD:279660 | 16/45 (36%) | ||
| KELCH repeat | 359..407 | CDD:276965 | 17/51 (33%) | ||
| KELCH repeat | 410..455 | CDD:276965 | 6/20 (30%) | ||
| Kelch_1 | 410..452 | CDD:279660 | 6/20 (30%) | ||
| Kelch_1 | 466..509 | CDD:279660 | |||
| KELCH repeat | 467..509 | CDD:276965 | |||
| BTB | 564..704 | CDD:279045 | |||
| BTB | 575..707 | CDD:197585 | |||
| SPOP_C_like | 707..766 | CDD:269810 | |||
| BTB | 798..898 | CDD:279045 | |||
| BTB | 802..902 | CDD:197585 | |||
| SPOP_C_like | 902..960 | CDD:269810 | |||
| KLHDC3 | XP_024302088.1 | PLN02193 | 63..>331 | CDD:330882 | 64/232 (28%) |
| KELCH repeat | 90..135 | CDD:276965 | 8/32 (25%) | ||
| KELCH repeat | 141..186 | CDD:276965 | 10/44 (23%) | ||
| KELCH repeat | 193..249 | CDD:276965 | 17/57 (30%) | ||
| KELCH repeat | 252..296 | CDD:276965 | 16/46 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1494 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.940 | |||||