DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lztr1 and klhdc2

DIOPT Version :9

Sequence 1:	NP_001259114.1	Gene:	Lztr1 / 31037	FlyBaseID:	FBgn0040344	Length:	998	Species:	Drosophila melanogaster
Sequence 2:	NP_001096337.1	Gene:	klhdc2 / 100124923	XenbaseID:	XB-GENE-1006177	Length:	159	Species:	Xenopus tropicalis

Alignment Length:	119	Identity:	34/119 - (28%)
Similarity:	56/119 - (47%)	Gaps:	15/119 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   299 PAPRYHHSAVVAGSSMFIFGGYTGDIHSNSNLTN-------KNDLFEYKFQSAMWVEWKFSGRQP 356
            ||.|..|.||..|.|:|::|||     .|:.:..       :::::.|..::..|...|..|..|
Frog    32 PAERSGHVAVTDGQSIFVWGGY-----KNAPVRGFYDFYLPRDEIWIYDMENGSWQRVKTKGEIP 91

  Fly   357 VPRSAHGAAVYDNKMWIYAGYDGNARLNDMWTLNLT---GENQWEEVDQLGDRP 407
            :..|...||..|..::::.|:..:...|..:.|||.   |:..||:||..|..|
Frog    92 LSMSGSCAACVDKVLYLFGGHHAHGNTNMFYMLNLNPRDGDLFWEKVDCKGIPP 145

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lztr1	NP_001259114.1	PLN02153	237..554	CDD:177814	34/119 (29%)
		KELCH repeat	252..298	CDD:276965
		Kelch_3	261..310	CDD:290151	6/10 (60%)
		Kelch_5	299..>329	CDD:290565	13/29 (45%)
		KELCH repeat	302..355	CDD:276965	15/59 (25%)
		Kelch_1	358..400	CDD:279660	12/44 (27%)
		KELCH repeat	359..407	CDD:276965	15/50 (30%)
		KELCH repeat	410..455	CDD:276965
		Kelch_1	410..452	CDD:279660
		Kelch_1	466..509	CDD:279660
		KELCH repeat	467..509	CDD:276965
		BTB	564..704	CDD:279045
		BTB	575..707	CDD:197585
		SPOP_C_like	707..766	CDD:269810
		BTB	798..898	CDD:279045
		BTB	802..902	CDD:197585
		SPOP_C_like	902..960	CDD:269810
klhdc2	NP_001096337.1	PLN02193	<32..>122	CDD:330882	24/94 (26%)
klhdc2	NP_001096337.1	KELCH repeat	35..91	CDD:276965	15/60 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1263405at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.920