DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:271 Identity:64/271 - (23%)
Similarity:102/271 - (37%) Gaps:74/271 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ILLAIAVRWGDALHRGIPVQQQNY----------------------GYVMQIYGPQF------LA 47
            :.||:||    |....||..:|..                      |.|..|.|..|      ..
  Fly     5 VFLALAV----AAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWC 65

  Fly    48 AGSLFSARYVLTVAHCFKKN---TKPEELSVRAGYRWIAWEFRGKQVAGLLRHPKFSPLTLRNDI 109
            .||:....:|||.|||....   |.....|:|...::..|...|    ..::|..::...|.|||
  Fly    66 GGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGSG----NFVQHHHYNSGNLHNDI 126

  Fly   110 AVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPP-----QELAGWNLM-------HIAQP----L 158
            :::|. ..:...|::|.:.|            |.     |:.|||..:       :...|    |
  Fly   127 SLIRT-PHVDFWHLVNKVEL------------PSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWL 178

  Fly   159 KSMSVQVEPEKNC-RQWFPQISGGVICASATMGEGLCYGDSGDPLIS--GGEVCGLAIAFRKCG- 219
            :::.||:..:.:| |.|  .:...:||.:...|:..|.||||.||::  |..:.|:.......| 
  Fly   179 QAVDVQIMSQSDCSRSW--SLHDNMICINTNGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAGC 241

  Fly   220 DKRYPALFTDV 230
            ....||:|:.|
  Fly   242 QSGAPAVFSRV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 54/222 (24%)
Tryp_SPc 38..237 CDD:214473 54/222 (24%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 56/235 (24%)
Tryp_SPc 38..262 CDD:238113 56/234 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.