DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:220 Identity:53/220 - (24%)
Similarity:95/220 - (43%) Gaps:25/220 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GYVMQIYGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAG---YRWIAWEFRGKQVAGLLR 96
            |..:...|..:...||:....:|||.|||   ....:|.|:..|   |...|:...... ...:|
  Fly    57 GVSLNSNGNWWWCGGSIIGHTWVLTAAHC---TAGADEASLYYGAVNYNEPAFRHTVSS-ENFIR 117

  Fly    97 HPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCS---RPLTPLNMFAPPQELAGWNLMH----I 154
            :|.:  :.|.:|:|:::......:| ::|.|.|.|   |..:..|.:.   :.|||..::    :
  Fly   118 YPHY--VGLDHDLALIKTPHVDFYS-LVNKIELPSLDDRYNSYENNWV---QAAGWGAIYDGSNV 176

  Fly   155 AQPLKSMSVQVEPEKNCRQWF--PQISGGVICASATMGEGLCYGDSGDPLIS--GGEVCGLAIAF 215
            .:.|:.:.::|.....|:.::  ...|...||.....|:..|.||||.||::  |.::.|:....
  Fly   177 VEDLRVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFV 241

  Fly   216 RKCG-DKRYPALFTDVHYHRAFIAQ 239
            ...| ....||.||.|..:..:|.:
  Fly   242 SAYGCQVGGPAGFTRVTKYLEWIKE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 52/215 (24%)
Tryp_SPc 38..237 CDD:214473 51/213 (24%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 52/216 (24%)
Tryp_SPc 41..266 CDD:238113 53/218 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.