DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG4815

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:259 Identity:71/259 - (27%)
Similarity:122/259 - (47%) Gaps:31/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQLILLAIAVR--------WGDALH----RGIPVQQQNYGYV-MQIY-GPQFLAAGSLFSARYVL 58
            ::|:|:..:||        |....|    .||....::.|.| :|:: |.:.:.:.:|.:.|::|
  Fly     8 VRLLLILNSVRTEAGNREEWTGRFHPRIYNGIKTTVESLGGVGIQLFNGRKLVCSATLLTPRHIL 72

  Fly    59 TVAHCFKKNTKPEELSVRAG----YRWIAWEFRGKQVAGLLRHPKFSPLTLRNDIAVLRVKAAIS 119
            |.|||| :|....:..|..|    :.|....|...::..:..|||::.:....|:||.:.|..: 
  Fly    73 TAAHCF-ENLNRSKFHVIGGKSAEFTWHGNNFNKNKLIRVQIHPKYAKMKFIADVAVAKTKYPL- 135

  Fly   120 HSHMINYIGLCSRPLTPLNMFAPPQELAGWNL------MHIAQPLKSMSVQVEPEKNC-RQWFPQ 177
            .|..|.|..||...|.|.:...    .|||..      ....:..:||.|.:..:::| :|...:
  Fly   136 RSKYIGYAQLCRSVLHPRDKLI----AAGWGFEGGVWDESRKKTFRSMKVGIVSKRDCEKQLDRK 196

  Fly   178 ISGGVICASATMGEGLCYGDSGDPLISGGEVCGLAIAFRKCGDKRYPALFTDVHYHRAFIAQAV 241
            :...:|||.|...:.||:||||.||:.|.:|||:.....|||:...|.::..|.|:..||.:.:
  Fly   197 MPPNIICAGAYNNKTLCFGDSGGPLLLGRQVCGINTWTFKCGNNEKPDVYMGVRYYAKFIKRTI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 61/212 (29%)
Tryp_SPc 38..237 CDD:214473 59/210 (28%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 62/215 (29%)
Trypsin 49..256 CDD:278516 60/212 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.