DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and SPE

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:224 Identity:59/224 - (26%)
Similarity:103/224 - (45%) Gaps:42/224 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFR----------GKQVA------- 92
            |...|:|.::|||||..||.......:..:|....|...|:.|          |:::.       
  Fly   164 FNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDI 228

  Fly    93 ----GLLRHPKFSPLTL--RNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQELAGWNL 151
                |:: |..::|.::  |||||::|:|..:|::..:..|.|.:..|...|......::|||.|
  Fly   229 EVEKGII-HEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGL 292

  Fly   152 MHIAQP----LKSMSVQVEPEKNCRQWFP----QISGGVICASATMGEGLCYGDSGDPLI----S 204
            ....||    || ::|.|....:|::.:.    ::....:||...:|...|.||||.||:    :
  Fly   293 TENMQPSAIKLK-ITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPIST 356

  Fly   205 GGE----VCGL-AIAFRKCGDKRYPALFT 228
            ||.    :.|: :...:.||.|.:|.::|
  Fly   357 GGRDVFYIAGVTSYGTKPCGLKGWPGVYT 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 59/224 (26%)
Tryp_SPc 38..237 CDD:214473 59/224 (26%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 59/224 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.