DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG31199

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:210 Identity:51/210 - (24%)
Similarity:74/210 - (35%) Gaps:56/210 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IPVQQQNYGYVMQI-YGPQFL-------AAGSLFSARYVLTVAHCF-KKNTKPEELSVRAGYR-- 80
            ||.:.|   :|.:| ||..|.       ..|.|.|.|.||..|||| :.|...|..||..|..  
  Fly    46 IPTEHQ---WVARIVYGKGFEGKIRDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNK 107

  Fly    81 -------------WIAWEFRGKQVAGLLRHPKFSPLTLRNDIAVLRVK--AAISHSHMINYIGLC 130
                         :.....:..::|.:..||.:...||:|.:|||.::  |.|    ..|.:.:|
  Fly   108 SAPVGVRVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNSLAVLTLQRDAKI----YPNVMPIC 168

  Fly   131 SRPLTPLNMFAPPQELAGWNLMHIAQPLKSMSVQVEPEKNCRQWFPQISGGVICASATMGEGLCY 195
                      .||..|....|  :||......::|..:...:.|.           .|:..|.|.
  Fly   169 ----------MPPPSLLNETL--VAQTFVVAGLRVFEDFRLKTWV-----------NTLSRGFCQ 210

  Fly   196 GDSGDPLISGGEVCG 210
            ......:.|...|||
  Fly   211 SKVKTLVTSSNTVCG 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 47/199 (24%)
Tryp_SPc 38..237 CDD:214473 47/199 (24%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 51/210 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.