DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG17475

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:292 Identity:65/292 - (22%)
Similarity:93/292 - (31%) Gaps:99/292 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ESLQLILLAIAVRWGDALHRGIPVQ--QQNYGYVMQ-IYGPQFLAAGSLFSARYVLTVAHCFKKN 67
            :.|:.|..|..|.:.:.:..|..||  :..|...:| :||.. :..|.:...|:|||.|||. ..
  Fly    33 DQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGGH-ICGGCIIDERHVLTAAHCV-YG 95

  Fly    68 TKPEELSVRAG--------------YRWIAWEFRGKQVAGLLRHPKFSPLTLRNDIAVLRVKAAI 118
            ..|..|.|..|              ..||              |..::.....||||::|:...|
  Fly    96 YNPTYLRVITGTVEYEKPDAVYFVEEHWI--------------HCNYNSPDYHNDIALIRLNDTI 146

  Fly   119 SHSHMINYIGLCSRPLTPLNMFAPPQE-------------LAGWN----------------LMHI 154
            .                 .|.:..|.|             |.||.                |.|:
  Fly   147 K-----------------FNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHV 194

  Fly   155 AQPLKSMSVQVEPEKN-CRQWFPQISGGVICASATMGEGLCYGDSGDPLISGGEVCGLAIAFRKC 218
            ........:..:|... |.          ||...|.|:|.|:||||.||...|.:.||......|
  Fly   195 VYSTCQEIMNNDPSNGPCH----------ICTLTTGGQGACHGDSGGPLTHNGVLYGLVNWGYPC 249

  Fly   219 GDKRYPALFTDVHYHRAFIAQAVLTLDREMLS 250
            . ...|....:|:|:..:|        |.|:|
  Fly   250 A-LGVPDSHANVYYYLEWI--------RSMIS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 54/245 (22%)
Tryp_SPc 38..237 CDD:214473 53/243 (22%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 57/261 (22%)
Tryp_SPc 50..269 CDD:238113 58/270 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.