DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG3505

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:213 Identity:52/213 - (24%)
Similarity:92/213 - (43%) Gaps:35/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GSLFSARYVLTVAHCFKK--NTKPEELSVRAGYRW------------------IAWEFRGKQVAG 93
            |.|.|.|||||.|||..:  .:..:..:||.| .|                  .|..::...:..
  Fly   139 GVLISDRYVLTAAHCVAQAATSNLQITAVRLG-EWDTSTNPDCQYHEDSKVADCAPPYQDIAIEE 202

  Fly    94 LLRHPKF--SPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQELAGWNLMHIAQ 156
            ||.||.:  :..|..||||::|:.:....:..:..|.|.::.|....:.....|:|||.... :|
  Fly   203 LLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGWQASS-SQ 266

  Fly   157 PLKSMSVQVEPEKNCRQWFP----QISGGVICASATMGEGLCYGDSGDPLI---SGGEVCGLAIA 214
            .::...|.:...:.|::.:.    :|....:|......|  |||::|.||:   :.|.:.|..::
  Fly   267 RMRKGYVTISSIEECQRKYASQQLRIQASKLCGLTNSQE--CYGNAGGPLMLFKNDGYLLGGLVS 329

  Fly   215 FR--KCGDKRYPALFTDV 230
            |.  .|.:..:|.::|.|
  Fly   330 FGPVPCPNPDWPDVYTRV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 52/213 (24%)
Tryp_SPc 38..237 CDD:214473 52/213 (24%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 52/213 (24%)
Tryp_SPc 111..354 CDD:214473 52/213 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.