DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG13318

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:236 Identity:60/236 - (25%)
Similarity:94/236 - (39%) Gaps:53/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FLAAGSLFSARYVLTVAH--------CFKKNTKPEELSVRAGYRWIAWEFRGKQ---------VA 92
            :|..|:|.:|::|||.||        .||         ||.|    .|:.....         ::
  Fly   187 YLGGGALITAQHVLTAAHKVYNLGLTYFK---------VRLG----EWDAASTSEPIPAQDVYIS 238

  Fly    93 GLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQELAGW--NLMHIA 155
            .:..:|.|:|..|:||:|:|::...:|.:.. :.:|....|.|  :.......:|||  |.....
  Fly   239 NVYVNPSFNPNNLQNDVAILKLSTPVSLTSK-STVGTVCLPTT--SFVGQRCWVAGWGKNDFGAT 300

  Fly   156 QPLKSMSVQVE----PEKNCR---------QWFPQISGGVICASATMGEGLCYGDSGDPLI--SG 205
            ...:::..||:    |..||:         ..|.......|||....|:..|.||.|.||:  |.
  Fly   301 GAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCTSN 365

  Fly   206 G--EVCGLAIAFRKCGDKRYPALFTDVHYHRAFIAQAVLTL 244
            |  .|.||......|.....|.::.:|..:..:| |..|||
  Fly   366 GVWYVVGLVAWGIGCAQAGVPGVYVNVGTYLPWI-QTTLTL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 56/229 (24%)
Tryp_SPc 38..237 CDD:214473 55/227 (24%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 57/231 (25%)
Tryp_SPc 169..399 CDD:214473 55/227 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.