DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and Jon74E

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:258 Identity:65/258 - (25%)
Similarity:99/258 - (38%) Gaps:86/258 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GIPVQQQNYGYVMQIYGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQ 90
            |:.:::.|..|..        ...||.|.||:||.|||.:|       :|...|          .
  Fly    48 GLSIEEPNDMYCW--------CGASLISDRYLLTAAHCVEK-------AVAITY----------Y 87

  Fly    91 VAGLLR----------------HPKFSPLTLRNDIAVLRV-KAAISHSHMINYIGLCS--RPLTP 136
            :.|:||                ||.::..:|.||||::|: :.|:          ||.  ||:..
  Fly    88 LGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDAL----------LCDSIRPIRL 142

  Fly   137 LNMFAP-------PQELAGWNLMH-----IAQPLKSMSVQVEPEKNCRQWFPQISGGVICASATM 189
            ..:.:.       |...:||..|:     |:..|:.:...||..::|...:..|....||...|.
  Fly   143 PGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTG 207

  Fly   190 GEGLCYGDSGDPLISGGEV------CGLAIAFRKCG-DKRYPALFT-------------DVHY 232
            |:..|.||||.||:....|      .|:....:|.| .|.||::||             .|||
  Fly   208 GKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGVHY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 62/246 (25%)
Tryp_SPc 38..237 CDD:214473 62/246 (25%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 62/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.