DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG11529

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:262 Identity:74/262 - (28%)
Similarity:104/262 - (39%) Gaps:60/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLAIAV----RWGDALHRGIPVQQQNYG------YVMQIYGPQ-----FLAAGSLFSARYVLTVA 61
            ||.:||    .|.........|.|..||      |.:.:.|.|     .|..|:|...|::||..
  Fly     9 LLGLAVIMLMMWKPTPTDSYAVGQSKYGRIEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAG 73

  Fly    62 HCFKKNTKPEELSVRAGYRWIAWEFRGKQVAG--LLR------HPKFSPLTLRNDIAVLRVKAAI 118
            ||....|   ...|..|.:.:    ...:|:|  :||      |.:|:|.|..||||::::...:
  Fly    74 HCTMGVT---HYDVYLGTKSV----EDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDV 131

  Fly   119 SHSHMINYIGLCSRPLTPLNMFAPPQELA-GWNLMHIAQPLKSMSVQ-----VEPEKNCRQWFPQ 177
            :.:..|....|.||  ...:.||....:| ||..|  .:...|.|:|     |.....|.|.:..
  Fly   132 AFTPRIQPASLPSR--YRHDQFAGMSVVASGWGAM--VEMTNSDSMQYTELKVISNAECAQEYDV 192

  Fly   178 ISGGVICASATMGEGLCYGDSGDPLI-----------SGGEVCGLAIAFRKCGDKRYPALFTDV- 230
            ::.|||||.....|.:|.||||.||:           |.|...|       | :...|..||.| 
  Fly   193 VTSGVICAKGLKDETVCTGDSGGPLVLKDTQIVVGITSFGPADG-------C-ETNIPGGFTRVT 249

  Fly   231 HY 232
            ||
  Fly   250 HY 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 64/226 (28%)
Tryp_SPc 38..237 CDD:214473 64/226 (28%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 65/234 (28%)
Tryp_SPc 37..255 CDD:214473 65/234 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.