DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and sphinx2

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:188 Identity:34/188 - (18%)
Similarity:69/188 - (36%) Gaps:62/188 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGK----------------------- 89
            ||::.|.:::|||          :|:.:   :::|...|..|                       
  Fly    57 AGTIISNQWILTV----------KEVLI---FKYIEAHFGSKRAFWGYDILRIYRENFYFHYDKT 108

  Fly    90 QVAGLLRHP--KFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQELAGWNL- 151
            ::..|::.|  ||       |..:.||:.....:....|:|         ||    ..:.||.. 
  Fly   109 RIIALVKCPYQKF-------DRRMSRVRVPAYGARFERYVG---------NM----TMVCGWGTD 153

  Fly   152 ---MHIAQPLKSMSVQVEPEKNCRQWFPQISGGVICASATMGEGLCYGDSGDPLISGG 206
               :.:...::.:.|:|.....|.::...:....:|.|....:|:|.||.|..:::.|
  Fly   154 KRKVRLPTWMRCVEVEVMNNTECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 34/188 (18%)
Tryp_SPc 38..237 CDD:214473 34/188 (18%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 34/188 (18%)
Tryp_SPc 26..248 CDD:304450 34/188 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.