DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG13527

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:238 Identity:57/238 - (23%)
Similarity:96/238 - (40%) Gaps:67/238 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YVMQI--------YGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQVA 92
            ||:.|        :|......|.|.|.::|:|.|||....:|   :..:|  ||:.      .||
  Fly    43 YVVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSK---IMYKA--RWLL------VVA 96

  Fly    93 GLLRHPKFSP----------------LTLRN--DIAVLRVKAAI-SHSHMINYIGLCSRPLTPLN 138
            |.....:::|                .|:.|  ::|:::::..: |:...|.::.|         
  Fly    97 GSPHRLRYTPGKSVCSPVSSLYVPKNFTMHNTFNMALMKLQEKMPSNDPRIGFLHL--------- 152

  Fly   139 MFAPPQE---------LAGWNLMHIAQPLKSMSVQVE----PEKNCRQWFPQISGGVICA---SA 187
                |:|         :.||..|:...||.....||:    ....|:.:|.....|::||   :.
  Fly   153 ----PKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYGDGMMCAGNNNW 213

  Fly   188 TMGEGLCYGDSGDPLISGGEVCGLAIAFRKCGDKRYPALFTDV 230
            |:....|.||.|.||:||..|.|:......||....|:::|||
  Fly   214 TIDAEPCSGDIGSPLLSGKVVVGIVAYPIGCGCTNIPSVYTDV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 55/236 (23%)
Tryp_SPc 38..237 CDD:214473 55/236 (23%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 57/238 (24%)
Tryp_SPc 43..263 CDD:214473 57/238 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.