DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG10764

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:242 Identity:54/242 - (22%)
Similarity:86/242 - (35%) Gaps:57/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQVAGLLRHPKFSPLTLRNDI 109
            |...|::...|:||:.|||.   .:..:|.||.|.|.|........|..:..|..|.....||||
  Fly    61 FQCGGTIIHMRFVLSAAHCL---VRGYDLYVRLGARNINEPAAVHTVINVFVHHDFIASEYRNDI 122

  Fly   110 AVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQ-----------ELAGWN------------- 150
            .:|::..:|.::..:.          |:.:|..|.           ...||.             
  Fly   123 GLLQLSESIVYTVRVQ----------PICIFLDPALKGSVEKLKTFRALGWGNRNGKLSIMLQTI 177

  Fly   151 -LMHIAQPLKSMSVQVEPEKNCRQWFPQISGGVICASATMGEGLCYGDSGDP-----LISGGEVC 209
             |:|:.:  .....::....|.||         |||....|: .|.||||.|     |....:..
  Fly   178 YLLHLKR--NECKRKLNFNLNSRQ---------ICAGTKNGD-TCRGDSGGPLSTNILFPSNKSY 230

  Fly   210 GLAIAFRKCGDK--RYPALFTDVHYHRAFIAQAVLTLDREMLSKSRG 254
            .:.:.....||.  |...::|||..:..:|:..:...|...:..|.|
  Fly   231 EVQLGIVSFGDPECRGVGVYTDVTSYVDWISSTIARNDYLPIGVSGG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 51/225 (23%)
Tryp_SPc 38..237 CDD:214473 50/223 (22%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 50/223 (22%)
Tryp_SPc 38..263 CDD:238113 51/226 (23%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.