DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and Jon44E

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:232 Identity:62/232 - (26%)
Similarity:100/232 - (43%) Gaps:46/232 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GIPVQQQNYGYVMQIYGPQF-----LAAGSLFSARYVLTVAHCFKKNTKPEEL-----SVRAGYR 80
            |.|..:   |.:..|.|..|     ...||:....:|||.|||  .|:....|     |.|...:
  Fly    44 GYPAYE---GKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHC--TNSANHVLIYFGASFRHEAQ 103

  Fly    81 WIAWEFRGKQVAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTP-----LNMF 140
            :..|..|    :.:::||.::.. |.||||::|    |.|   :::..|.::...|     .|.:
  Fly   104 YTHWVSR----SDMIQHPDWNDF-LNNDIALIR----IPH---VDFWSLVNKVELPSYNDRYNSY 156

  Fly   141 APPQELA-GWNLMH----IAQPLKSMSVQVEPEKNCRQWFPQ--ISGGVICASATMGEGLCYGDS 198
            :....:| ||.|..    ::..|..:.||:....:||.::..  |:...||.:...|:..|.|||
  Fly   157 SGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDS 221

  Fly   199 GDPLI--SGGEVCGLAIAF---RKCGDKRYPALFTDV 230
            |.||:  ....:.|: ::|   ..|...| ||.||.|
  Fly   222 GGPLVLHDNNRIVGI-VSFGSGEGCTAGR-PAGFTRV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 59/220 (27%)
Tryp_SPc 38..237 CDD:214473 59/220 (27%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 62/232 (27%)
Tryp_SPc 41..266 CDD:238113 62/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.