DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:241 Identity:57/241 - (23%)
Similarity:96/241 - (39%) Gaps:54/241 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQLILLAIAVRWGDALH-RGIPVQQQNYGYVMQIYGPQF------------------LAAGSLFS 53
            |.|.|.|::......:| :.:|...:..|.::..| |.:                  ...||:.:
  Fly     7 LALALAAVSAETVQQVHPKDLPKDTKINGRIVNGY-PAYEGKAPYTVGLGFSGNGGWWCGGSIIA 70

  Fly    54 ARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQVAGLLRHPKFS---------PLTLRNDI 109
            ..:|||.|||   .....::::..|..|        :......|...|         |....|||
  Fly    71 HDWVLTAAHC---TNGASQVTIYYGATW--------RTNAQFTHTVGSGDFIQNHNWPNQNGNDI 124

  Fly   110 AVLRVKAAISHSHMINYIGLCS---RPLTPLNMFAPPQELA-GWNLMHI-AQP--LKSMSVQVEP 167
            |::|. ..:...||:|.:.|.|   |    .||:.....:| ||.|... :||  ::.:.:|:..
  Fly   125 ALIRT-PHVDFWHMVNKVELPSFNDR----YNMYDNYWAVACGWGLTTAGSQPDWMECVDLQIIS 184

  Fly   168 EKNCRQWFPQISGGVICASATMGEGLCYGDSGDPLI--SGGEVCGL 211
            ...|.:.:.....|::|.|.:.|:..|.||||.||:  .||.:.|:
  Fly   185 NSECSRTYGTQPDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLVGV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 50/210 (24%)
Tryp_SPc 38..237 CDD:214473 50/210 (24%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 50/212 (24%)
Tryp_SPc 37..260 CDD:238113 50/211 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.