DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG31220

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:219 Identity:62/219 - (28%)
Similarity:93/219 - (42%) Gaps:50/219 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWE----FRGKQ-----------VAGLLRHP 98
            |||.:.|||||.|||. .:|..:...||.|....:..    .||.:           |..:..|.
  Fly   141 GSLINTRYVLTAAHCV-TDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHN 204

  Fly    99 KFSP--LTLRNDIAVLRVKAAISHSHMINYIGLC----SRPLTPLNMFAPPQELAGWNLMHI--- 154
            .:.|  .|.|||||::|:|..:.::  :.|..:|    .|.|....|:     :|||....:   
  Fly   205 DYDPANYTFRNDIALVRLKEPVRYT--MAYYPICVLDYPRSLMKFKMY-----VAGWGKTGMFDT 262

  Fly   155 -AQPLKSMSVQVEPEKNC------RQWFPQISGGVICASATMGEGLCYGDSGDPLI--SGGE--- 207
             ::.||..:|:|...:.|      |.:.|:..   |||......|.|.||||.||:  ||..   
  Fly   263 GSKVLKHAAVKVRKPEECSEKYAHRHFGPRFQ---ICAGGLDNRGTCDGDSGSPLMGTSGRSYET 324

  Fly   208 ---VCGLAIAFRKCGDKRYPALFT 228
               :.|:......||...:|::||
  Fly   325 ITFLAGITSYGGPCGTIGWPSVFT 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 62/219 (28%)
Tryp_SPc 38..237 CDD:214473 62/219 (28%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 62/219 (28%)
Tryp_SPc 104..360 CDD:238113 62/219 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.