DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG8952

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:183 Identity:38/183 - (20%)
Similarity:71/183 - (38%) Gaps:44/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LAAGSLFSARYVLTVAHC----------------FKKNTKPEELSVRAGYRWIAWEFRGKQVAGL 94
            |..||:.|..:|||.|||                |..|.    |::.:.              .:
  Fly    64 LCGGSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNANA----LNMTSN--------------NI 110

  Fly    95 LRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQELAGW-----NLMHI 154
            :.||.::. .|.||::::::...::.|..|..|.|..:....::.......:||:     ..:..
  Fly   111 IIHPDYND-KLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDY 174

  Fly   155 AQPLKSMSVQVEPEKNCRQWFPQ--ISGGVICASATMGEGL--CYGDSGDPLI 203
            ::.|....|::....:|...:.:  :....:||....|..:  |.||||.|||
  Fly   175 SETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 38/183 (21%)
Tryp_SPc 38..237 CDD:214473 38/183 (21%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 38/183 (21%)
Tryp_SPc 38..271 CDD:238113 38/183 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.