DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG31269

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:205 Identity:55/205 - (26%)
Similarity:88/205 - (42%) Gaps:31/205 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GSLFSARYVLTVAHCFKKNTKPEELSV-------RAGYRWIAWEFRGKQVAGLLRHPKFSPLTLR 106
            |::.:..:|||.|||.:....|..:.|       :.|.|:.        :..:..|..:....:.
  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYF--------LKAIHIHCNYDNPEMH 122

  Fly   107 NDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQE--LAGW--NLMHIAQP--LKSMSVQV 165
            ||||:|.:...|:.......|.|   ||.|:.   |..|  |.||  .::....|  |:.:.:|.
  Fly   123 NDIALLELVEPIAWDERTQPIPL---PLVPMQ---PGDEVILTGWGSTVLWGTSPIDLQVLYLQY 181

  Fly   166 EPEKNCRQWF---PQISGGVICASATMGEGLCYGDSGDPLISGGEVCGLAIAFRKCGDKRYPALF 227
            .|.:.|:...   .....|.||..:.:|||.|:||||.||:|.|.:.||......|. ...|.:.
  Fly   182 VPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVH 245

  Fly   228 TDVHYHRAFI 237
            ..|:::|.:|
  Fly   246 ASVYFYRDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 55/205 (27%)
Tryp_SPc 38..237 CDD:214473 54/203 (27%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 54/203 (27%)
Tryp_SPc 38..258 CDD:238113 55/205 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.