DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG31205

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:218 Identity:48/218 - (22%)
Similarity:84/218 - (38%) Gaps:45/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IPVQQQNYGYVMQIYG------PQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWE 85
            |..:...:.:|::|.|      ...|..|.|..:|.|:|.|||..|:   |..|:   |..:..:
  Fly    42 IIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKD---ESESI---YGVVFGD 100

  Fly    86 FRGKQ---VAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQELA 147
            .....   |:.:..||.:||....||:|::.:...:..|.::..|.|.|     ::...|..|.:
  Fly   101 SDSSNINLVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPS-----VSEMVPGSETS 160

  Fly   148 GWNLM------------HIA-----QPLKSMSVQVEPEKNCRQWFPQISGGVICA----SATMGE 191
            ...|:            |.|     :.:|....::: .|.|.:...:....:||.    |...|.
  Fly   161 NSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKID-SKECHEKQARFPEELICGHTERSPLSGS 224

  Fly   192 GLCYGDSGDPLISGGEVCGLAIA 214
            .|... ||.|  ....:.|:|:|
  Fly   225 ALTEA-SGTP--RQFHLLGIAVA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 46/207 (22%)
Tryp_SPc 38..237 CDD:214473 46/207 (22%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 31/134 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.