DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and spirit

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:241 Identity:55/241 - (22%)
Similarity:95/241 - (39%) Gaps:57/241 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GIPVQQQNYGYV----------MQIYGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYR 80
            |:|.:.:.:.::          .:||   :...|:|.:..:|||.|||.....:|.......|..
  Fly   135 GMPTRPREFPFMAALGWRSNFDQRIY---YRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196

  Fly    81 WIAWEFRGKQVAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRP-LTPLNMFAPPQ 144
            ....|.....:..::.||.:|..|..||||:|.::.|             ::| |.|..::...:
  Fly   197 LTLTEGEDISIRRVIIHPDYSASTAYNDIALLELETA-------------AKPELKPTCIWTQKE 248

  Fly   145 --------------ELAGWNLMHIAQ-PLKSMSVQVEPEKNCRQWF--PQISGGVI----CASAT 188
                          ..||.:...:.: ||||:|     .:.|:..:  .|::.||:    ||...
  Fly   249 VTNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVS-----NEECQHHYQKDQLAQGVLGTQMCAGDI 308

  Fly   189 MGE-GLCYGDSGDPLISGGEVCGLAIAFRKCGD---KRYPALFTDV 230
            .|| ..|.||||.||:....:.|..:.....|.   ...|:::|.|
  Fly   309 TGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQGCASGPPSVYTRV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 53/219 (24%)
Tryp_SPc 38..237 CDD:214473 53/219 (24%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 55/241 (23%)
Tryp_SPc 132..361 CDD:214473 55/241 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.