DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG14780

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:223 Identity:58/223 - (26%)
Similarity:94/223 - (42%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIA-------WEFRG----KQVAGL 94
            :|...:..|:|.:.|.|||.|||...|.:..   .|....::.       :|.|.    .||:.:
  Fly    59 FGSGHICGGALIAPRKVLTAAHCLYNNQRKR---FRRASEFVVVLGTLNRFEHRNGTIVSQVSSM 120

  Fly    95 LRHPKFSPLTLRNDIAVLRVKAAISHS-----HMINYIGLCSRPLTPLNMFAPPQEL---AGWNL 151
            .....|||.::|:|:.:|.::..:..|     |      |...|:.......||.:|   |||..
  Fly   121 AYMHTFSPDSMRDDVGILFLRTGLPMSPGGGVH------LTVAPIQLAGQITPPGKLCQVAGWGR 179

  Fly   152 MH---IAQPLKSMSVQVEPEKNCRQWFPQISG---GVICASATM-GEGLCYGDSGDPLISGGEVC 209
            ..   ::..|.:.:|.....:.||..:.  ||   |::||.... |...|.||||.||:..|.:.
  Fly   180 TEQSSLSNILLTANVSTIRHQTCRMIYR--SGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLV 242

  Fly   210 GLAIAFRKCGDKRYPALFTDVHYHRAFI 237
            |:......|.:...|.::.||.|:|.:|
  Fly   243 GVVSWGYGCAEPGLPGVYVDVEYYRQWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 58/223 (26%)
Tryp_SPc 38..237 CDD:214473 57/221 (26%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 57/221 (26%)
Tryp_SPc 33..271 CDD:238113 58/223 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.