DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and HGF

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_000592.3 Gene:HGF / 3082 HGNCID:4893 Length:728 Species:Homo sapiens


Alignment Length:245 Identity:61/245 - (24%)
Similarity:100/245 - (40%) Gaps:47/245 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GIPVQQQNYGYVMQI-YGPQFLAAGSLFSARYVLTVAHCF-KKNTKPEELSVRAGYRWIAW---- 84
            |||. :.|.|:::.: |..:.:..|||....:|||...|| .::.|..|          ||    
Human   498 GIPT-RTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYE----------AWLGIH 551

  Fly    85 EFRGK---------QVAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRP-LTPLNM 139
            :..|:         .|:.|:..|:.|.|.|........:...:|...:.|| | |:.| .|..::
Human   552 DVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNY-G-CTIPEKTSCSV 614

  Fly   140 FAPPQELAGW---NLMHIAQPLKSMSVQVEPEKNCRQWF---PQISGGVICASA-TMGEGLCYGD 197
            :       ||   .|::....|:...:.:...:.|.|..   ..::...|||.| .:|.|.|.||
Human   615 Y-------GWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGD 672

  Fly   198 SGDPLISGGE----VCGLAIAFRKCGDKRYPALFTDVHYHRAFIAQAVLT 243
            .|.||:....    |.|:.:..|.|.....|.:|..|.|:..:|.:.:||
Human   673 YGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILT 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 54/227 (24%)
Tryp_SPc 38..237 CDD:214473 53/225 (24%)
HGFNP_000592.3 PAN_APPLE 39..122 CDD:238074
KR 126..208 CDD:214527
KR 210..290 CDD:214527
KR 304..384 CDD:214527
KR 388..470 CDD:238056
Tryp_SPc 494..716 CDD:214473 58/237 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143007
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.