Sequence 1: | NP_569865.1 | Gene: | CG11664 / 31033 | FlyBaseID: | FBgn0040341 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006135.2 | Gene: | GZMA / 3001 | HGNCID: | 4708 | Length: | 262 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 57/205 - (27%) |
---|---|---|---|
Similarity: | 92/205 - (44%) | Gaps: | 37/205 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 LAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQVAGLLR---HPKFSPLTLRN 107
Fly 108 DIAVLRV--KAAISHSHMINYIGLCSRP-----LTPLNMFAPPQELAGWNLMH----IAQPLKSM 161
Fly 162 SVQVEPEKNCR-----QWFPQISGGVICA-SATMGEGLCYGDSGDPLISGGEVCGLAIAF---RK 217
Fly 218 CGDKRYPALF 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11664 | NP_569865.1 | Tryp_SPc | 38..239 | CDD:304450 | 57/205 (28%) |
Tryp_SPc | 38..237 | CDD:214473 | 57/205 (28%) | ||
GZMA | NP_006135.2 | Tryp_SPc | 29..254 | CDD:238113 | 57/205 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165143058 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |