DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and GZMA

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_006135.2 Gene:GZMA / 3001 HGNCID:4708 Length:262 Species:Homo sapiens


Alignment Length:205 Identity:57/205 - (27%)
Similarity:92/205 - (44%) Gaps:37/205 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQVAGLLR---HPKFSPLTLRN 107
            :.||:|.:..:|||.||| ..|.:.:   |..|...|..|...||:..:.:   :|.:.|.|...
Human    53 ICAGALIAKDWVLTAAHC-NLNKRSQ---VILGAHSITREEPTKQIMLVKKEFPYPCYDPATREG 113

  Fly   108 DIAVLRV--KAAISHSHMINYIGLCSRP-----LTPLNMFAPPQELAGWNLMH----IAQPLKSM 161
            |:.:|::  ||.|:     .|:.:...|     :.|..|.    ::|||...|    .:..|:.:
Human   114 DLKLLQLMEKAKIN-----KYVTILHLPKKGDDVKPGTMC----QVAGWGRTHNSASWSDTLREV 169

  Fly   162 SVQVEPEKNCR-----QWFPQISGGVICA-SATMGEGLCYGDSGDPLISGGEVCGLAIAF---RK 217
            ::.:...|.|.     .:.|.|...::|| |...|...|.||||.||:..|...|:. :|   .|
Human   170 NITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVT-SFGLENK 233

  Fly   218 CGDKRYPALF 227
            |||.|.|.::
Human   234 CGDPRGPGVY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 57/205 (28%)
Tryp_SPc 38..237 CDD:214473 57/205 (28%)
GZMANP_006135.2 Tryp_SPc 29..254 CDD:238113 57/205 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143058
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.