DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and Gzmk

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:224 Identity:58/224 - (25%)
Similarity:95/224 - (42%) Gaps:35/224 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GIPVQQQNYGYVMQI-YGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGK 89
            |..||..:..::..| |..:.:..|.|...::|||.|||:.:...|   :|..|...::.....|
  Rat    29 GREVQPHSRPFMASIQYRGKHICGGVLIHPQWVLTAAHCYSRGHSP---TVVLGAHSLSKNEPMK 90

  Fly    90 QVAGLLRHPKFSPL-TLRNDIAVLRVKAA--------ISHSHMINYIGLCSRPLTPLNMFAPPQE 145
            |...:.....||.. :..|||.:::::.|        :.|....|||    |..|..       :
  Rat    91 QTFEIKEFIPFSGFKSGTNDIMLIKLRTAAELNKHVQLLHLRSKNYI----RDGTKC-------Q 144

  Fly   146 LAGW-----NLMHIAQPLKSMSVQVEPEKNC--RQWF---PQISGGVICASATMGE-GLCYGDSG 199
            :.||     :::..:..|:.::|.:...|.|  :.::   |.|:..:|||....|| ..|.||||
  Rat   145 VTGWGSTKPDVLTTSDTLQEVTVTIISRKRCNSQSYYNHKPVITKDMICAGDRRGEKDSCKGDSG 209

  Fly   200 DPLISGGEVCGLAIAFRKCGDKRYPALFT 228
            .|||..|....|.....|||....|.::|
  Rat   210 GPLICKGVFHALVSGGYKCGISNKPGVYT 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 55/212 (26%)
Tryp_SPc 38..237 CDD:214473 55/212 (26%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 58/224 (26%)
Tryp_SPc 26..251 CDD:238113 58/224 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336729
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.