DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG33225

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:256 Identity:49/256 - (19%)
Similarity:93/256 - (36%) Gaps:67/256 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VMQIYGPQFLAAGSLFSARYVLTVAHC------------FKKN-TKPEELSVRAGYRWIAWEFRG 88
            ||.:.......:|||.:..:|||.|.|            :.:| |..:..|:|            
  Fly    72 VMVLGENNVFCSGSLITRLFVLTSASCLLSLPKQVILGEYDRNCTSADCTSIR------------ 124

  Fly    89 KQVAGL---LRHPKFSPLTLRN-DIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQELAGW 149
             ||..:   :.|.:|...|::. |||:||:...:|.|..:..|  |......:..........||
  Fly   125 -QVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPI--CLSVDRQVGRSVQHFTATGW 186

  Fly   150 NLMHIAQP---LKSMSVQVEPEKNCRQWFPQ-ISGGVICASATMGEGLCYGDSGDPLISGGEVCG 210
            ......:|   |:::::.....|.|:....| |....:|..... :..|.||:|.|         
  Fly   187 GTTEWNEPSTILQTVTLSKINRKYCKGRLRQNIDASQLCVGGPR-KDTCSGDAGGP--------- 241

  Fly   211 LAIAFRKCGDKRYP---------------------ALFTDVHYHRAFIAQAVLTLDREMLS 250
            |::..:..||.::.                     .::|:|.::..:|.:.:...:.|.::
  Fly   242 LSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSGIGVYTNVEHYMDWIVRTINKSNTEKIA 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 47/242 (19%)
Tryp_SPc 38..237 CDD:214473 46/240 (19%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 47/241 (20%)
Tryp_SPc 57..292 CDD:238113 48/244 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.