DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG33226

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:258 Identity:58/258 - (22%)
Similarity:89/258 - (34%) Gaps:95/258 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILLAIAVRWGDALHRG----------IPVQQQNYG----------YVMQIY--GPQFLAAGSLF 52
            |:...:|:|..::|.:.          :.|::|..|          :::||.  |..| ..|||.
  Fly    14 LVCFILALRSYESLGQDLLDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHF-CGGSLI 77

  Fly    53 SARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQVAGLLRHPKFSPLTLR----------- 106
            |:.:|||.|||..:    ..|.||.|                    ::|.:|.|           
  Fly    78 SSLFVLTAAHCHSR----YRLKVRFG--------------------RYSGITPRYLCSSQYCSPF 118

  Fly   107 -NDIAVLRVKAAISHSHMINY------------IGLCSRPLTPLN---------------MFAPP 143
             .:|.|.|:....|:....||            ..:.:||:..|.               ||   
  Fly   119 GPEIDVKRIFLHSSYRDYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMF--- 180

  Fly   144 QELAGWNLMH---IAQPLKSMSVQVEPEKNCRQWFP-QISGGVICASATMGEGLCYGDSGDPL 202
             .:.||....   .:..|::.|:.....|.|.|.|. :|....|||..:. ...|.||||.||
  Fly   181 -NVTGWGKTESQLTSTILQTTSLFHLDRKFCAQIFDRKIGWPHICAGHSQ-SSTCTGDSGGPL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 51/210 (24%)
Tryp_SPc 38..237 CDD:214473 51/210 (24%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 52/225 (23%)
Tryp_SPc 47..282 CDD:214473 52/225 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.