DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG33461

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:297 Identity:72/297 - (24%)
Similarity:111/297 - (37%) Gaps:76/297 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAVVESLQLILL--------------AIAVRWGDALHRGIPVQQQNYGYVMQIYGP-QFLAAGS 50
            |..::..|.|.:|              .:..|....:..|.|.:...|.::..::.| .||.|||
  Fly     6 MKTIIAYLALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGS 70

  Fly    51 LFSARYVLTVAHCFKKNTKPEELSVRAGYR--------------WIAWEFRGKQVAGLLRHPKFS 101
            |.:..:|||.|||.:.:.   ||..|.|..              ....|:   .|..|.:|..:.
  Fly    71 LINQWFVLTSAHCIEDDV---ELIARLGENNRDNDIDCENNRCLEATQEY---NVDMLFKHRLYD 129

  Fly   102 PLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQ-----------ELAGWNLMHIA 155
            |....|||.:||::..:.:::.|.          |:.:|...:           :..||.|....
  Fly   130 PKDFSNDIGMLRLERRVEYTYHIQ----------PICIFHHRRMQLVVDQITWFKATGWGLTSTD 184

  Fly   156 QPLKSMSVQVE------PEKNCRQWFPQ-ISGGVICASATMGEGLCYGDSGDP-----LISGGE- 207
            ...||..|.:|      |..:|.:.|.| ...|.|||....| .||.||||.|     ||.|.: 
  Fly   185 LNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQICAGNDDG-NLCRGDSGGPQGRYVLIFGMKR 248

  Fly   208 --VCGLA-IAFRKCGDKRYPALFTDVHYHRAFIAQAV 241
              ..|:| ..:..|..   .::.|||..:..:|.:.|
  Fly   249 FVQMGIASFTYENCSK---VSILTDVVRYGRWIKKVV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 63/242 (26%)
Tryp_SPc 38..237 CDD:214473 62/240 (26%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 65/256 (25%)
Tryp_SPc 42..281 CDD:238113 66/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.